Matras1.1 : Help Page for 3D Library Search


Help Page
"3D Library Search"


This is for searching similar structures of a query structure within a large number of library structures. Among the several services of our server, only this search service returns the result by E-mail, because it requires long computational times (20-40 minutes). A user can upload a PDB file as a query structure, and the result will contain a list of similar library structures ranked by the Z-score and all of the pairwise alignments between the query and similar library structures. Two kinds of library sets, the PDB representative list (updated weekly) and the SCOP domain representative list are available. The latter list is useful when a user wants to know the domain configuration of a query structure.

An example of the result of "3D Library Search" is shown at the end of this page. Basically, the result is composed of following six parts:


#### MATRAS VER 1.1: PROGRAM FOR PROTEIN 3D STRUCTURE COMPARISON ####
# coded by Takeshi Kawabata. Last Modified : Apr 4, 2003
#
# Takeshi Kawabata and Ken Nishikawa.
# "Protein Structure Comparison Using the Markov Transition Model of Evolution".
#   Proteins vol.41:108-122(2000).
# "/var/www/html/matras/cgi-bin/Matras L -Q 4azuA.bssp -L /usr/DB/RepPDB/03Apr2/40pdb03Apr2.list "
# "Apr 4,2003 18:16:9"
# L:ONE-VS-LIBRARY COMPARISON
#
# QueFile "L" LibFile "4azuA.bssp"
# SseAliType T EnvAliType T AlgType L
# ssescfile "3U" envscfile "env-3U.rom" DisSc N disscfile "3U" DisScE - EnvType T Nenvstate 10
# GapExtE -6.0 GapExtD -100.0 Nkeep 35 Nrep 10 SseOffsetD 0
[QUERY_PROTEIN]  4azuA.bssp
[QUERY_COMPND]   AZURIN (PH 5.5)
[QUERY_SIZE]     Naa 128 Nsse 10
[MAX_NAAB]       1507
[LIBRARY_FILE]   /usr/DB/RepPDB/03Apr2/40pdb03Apr2.list
[LIBRARY_SIZE]   4401
[WAY_OF_RANKING] DisSc Ncmp^2-fitting Zsc ( 2.591349 *x*x + -196.758 SD 2097.125 )
[Z_THRESHOLD]    6.000000
[NRANK]          25 

[BEST_SCORE_RANKING]
rk  entry  start  end    Rdis  Zsc   SqID   MOLECULAR NAME                                    
1   1jzgA       1    128  93.7  57.54 100.0 "AZURIN"
2   1qhqA      15    139  61.1  37.73  29.2 "AURACYANIN"
3   1e30A      37    155  35.2  22.08  15.4 "RUSTICYANIN"
4   1fwxA     486    579   3.7  18.85  18.5 "NITROUS OXIDE REDUCTASE"
5   1kv7A      43    163   4.8  15.73  14.3 "PROBABLE BLUE-COPPER PROTEIN YACK"
6   1cyx-     126    225  23.7  15.02  10.2 "CYOA"
7   2cuaA      78    167  29.9  14.06  17.0 "CUA"
8   1fftB     126    225  13.3  13.87   8.0 "UBIQUINOL OXIDASE"
9   1ehkB      78    167  22.4  13.20  17.0 "BA3-TYPE CYTOCHROME-C OXIDASE"
10  1bxaA      17    105  30.1  11.16  20.2 "AMICYANIN"
11  1ibyA      31    111  25.2  10.55  13.6 "NITROSOCYANIN"
12  1ikoP      31    168  27.8  10.20   8.1 "EPHRIN-B2"
13  1kcw-     239    336   0.9   9.94  11.0 "CERULOPLASMIN"
14  1bqk-       1     93  23.1   9.24  23.0 "PSEUDOAZURIN"
15  1l4iA       1    116  15.0   8.68   6.3 "SFAE PROTEIN"
16  1n0lA       1    116  12.9   8.55  11.3 "CHAPERONE PROTEIN PAPD"
17  1plc-       1     99  28.0   8.16  15.2 "PLASTOCYANIN (CU2+, PH 6.0)"
18  2cbp-       1     96  27.8   7.77  14.3 "CUCUMBER BASIC PROTEIN"
19  1m56B     191    270   8.3   7.66  14.1 "CYTOCHROME C OXIDASE"
20  1hxmA       2    118  14.9   7.21   9.5 "GAMMA-DELTA T-CELL RECEPTOR"
21  1jer-       2    106  25.7   7.02  11.5 "CUCUMBER STELLACYANIN"
22  1nif-     215    323   6.0   6.71  17.2 "NITRITE REDUCTASE"
23  1aozA     203    299   2.3   6.37  12.8 "ASCORBATE OXIDASE (E.C.1.10.3.3)"
24  1gff2      53    149  13.1   6.32  10.1 "BACTERIOPHAGE G4 CAPSID PROTEINS GPF, GPG, GPJ"
25  1ten-     803    891  24.4   6.04  12.8 "TENASCIN (THIRD FIBRONECTIN TYPE III REPEAT)"

[BEST_SCORE_RANKING_WITH_DETAILED_INFORMATION]
rk  entry  Naa  Ncmp SqID  rms  Ssse  Rsse   Sdis  Rdis  Zsc   RelS  RelO  TAXONOMY            
1   1jzgA   128  128 100.0  0.8  2585  94.5 162932  93.7  57.54 100.0 100.0 [b.6.1]
2   1qhqA   139  120  29.2  2.1  1414  59.4 116237  61.1  37.73  98.9  99.7 [b.6.1]
3   1e30A   153  104  15.4  2.7  1114  26.5  74144  35.2  22.08  83.6  98.1 [b.6.1]
4   1fwxA   591   92  18.5  2.0   994   2.6  61265   3.7  18.85   5.6  12.0 [b.69.3]
5   1kv7A   463   98  14.3  3.4   811   4.1  57674   4.8  15.73   7.3  15.5 [b.6.1]
6   1cyx-   158   88  10.2  2.3   911  22.3  51366  23.7  15.02  56.3  87.6 [b.6.1]
7   2cuaA   122   88  17.0  2.3   873  32.3  49362  29.9  14.06  70.9  96.0 [b.6.1]
8   1fftB   257   88   8.0  2.4   526   8.8  48948  13.3  13.87  27.6  51.5 [f.2.1]
9   1ehkB   166   88  17.0  2.4   875  28.5  47549  22.4  13.20  53.2  84.7 [f.2.1]
10  1bxaA   105   89  20.2  3.7  1081  35.0  43728  30.1  11.16  71.4  96.2 [b.6.1]
11  1ibyA   112   81  13.6  2.6   791  31.4  38921  25.2  10.55  59.9  90.8 [b.6.1]
12  1ikoP   141  111   8.1  4.2   935  33.8  53117  27.8  10.20  66.1  93.8 [b.6.1]
13  1kcw-  1017   91  11.0  4.8   812   0.8  42116   0.9   9.94   1.7   3.6 [b.6.1]
14  1bqk-   124   87  23.0  3.6   820  30.3  38793  23.1   9.24  54.8  86.2 [b.6.1]
15  1l4iA   189   95   6.3  3.7   568   9.5  41394  15.0   8.68  32.7  59.8 [b.1.11]
16  1n0lA   215   97  11.3  3.9   553   7.0  42108  12.9   8.55  26.6  49.9 [b.1.11]
17  1plc-    99   92  15.2  4.2   796  32.1  38848  28.0   8.16  66.4  93.9 [b.6.1]
18  2cbp-    96   91  14.3  3.9   734  33.2  37563  27.8   7.77  66.1  93.8 [b.6.1]
19  1m56B   260   78  14.1  3.9   870  20.7  31635   8.3   7.66  14.6  29.4 [f.2.1]
20  1hxmA   206  105   9.5  4.2   524   7.0  43497  14.9   7.21  32.3  59.1 [b.1.1]
21  1jer-   110   96  11.5  4.1   845  34.8  38397  25.7   7.02  61.0  91.3 [b.6.1]
22  1nif-   333   99  17.2  7.0   900   8.7  39270   6.0   6.71   9.8  20.3 [b.6.1]
23  1aozA   552   94  12.8  7.1   841   3.4  36051   2.3   6.37   3.6   7.7 [b.6.1]
24  1gff2   177   89  10.1  5.5   472   9.8  33593  13.1   6.32  27.2  50.8 [b.10.1]
25  1ten-    89   86  12.8  4.1   433  19.9  31630  24.4   6.04  57.9  89.1 [b.1.2]


[BEST_RANKING_WITH_ONE_LINE_SECONDARY_STRUCTURE]
rk  entry  staQ |staL |    .    .    .   .    :    .   .    .    .   +    .    .   | endL| endQ
   (query )    1|  ---|ccEEEccccEEccEEEEccHHHcEEcHHHHHHccccccEEcccEEEEccccEEccccEEE|---  |128  
1   1jzgA      1|    1|ccEEEccccEEccEEEEccHHHcEEcHHHHHcccccccEEcccEEEEccccEEccccEEE|128  |128  
2   1qhqA      1|   15|cEEEEccccEEEcEEEEccc-ccEEHHHHHHcccccccEEcccEEEE-ccEEEccccEEE|139  |128  
3   1e30A      2|   37|-EEEEccEEEEccEEEEcc--ccEEcccc-c---ccccEEcccEEEc-ccEEEccccEEE|155  |128  
4   1fwxA      2|  486|-EEEEEcEcEEEcEEEEcccccEEc-------------EEEEcEEEEc-cEEEccccEEE|579  |128  
5   1kv7A      1|   43|ccEEEEEEcEEEcEEEEc--cccEEcc----------ccccccEEEEcccEEEcHHHcEE|163  |128  
6   1cyx-      2|  126|-EEEEEcEEEEEccEEEc---cEEc-------------EEEEccEEc-ccEEEcccccEE|225  |128  
7   2cuaA      2|   78|-EEEEEcEcEEEcEEEEc---cEEc-------------cEEEccEEEcccEEEccccEEE|167  |128  
8   1fftB      2|  126|-cEEEcccEccccEEEcc---cEEc-------------EEEEccEEEc-ccEccccccEc|225  |128  
9   1ehkB      2|   78|-EEEEEcEcEEEcEEEEc---cEEc-------------cEEcccEEEcccEEEccccEEE|167  |128  
10  1bxaA      1|   17|ccEEEEcEcEE-ccEEEc--cccEccc---------ccEEcccEEEcc--EEEc-ccEEE|105  |128  
11  1ibyA     11|   31|-----EEEcEEEcEEEEc--ccEEc-------------EEEEcEEEEcc-EEccccccEE|111  |128  
12  1ikoP      2|   31|-ccEEcccEEcccEEEccccccEEEHHHc-----ccc-cEEcccEEEcccEEEccHHEEE|168  |128  
13  1kcw-     11|  239|-----EEcccEEEEEEEcc-ccEEccc-------cccc-EEEcEEEEcc-EEEcHHHEEE|336  |128  
14  1bqk-      3|    1|-cEEEEEEcEEc-cEEEc---ccEccc---------cccccc-cEEcc--EEEc-ccEEE|93   |128  
15  1l4iA     12|    1|------EEcEEEcEEEEcccEEEEEccc--------cEEcEEcEEEEcccEEEEcE-EEE|116  |128  
16  1n0lA     12|    1|------EEcEEEcEEEEccc-EEEEccEc-------cEEcEEcEEEEcccEEEEEE-EEE|116  |128  
17  1plc-      5|    1|--cEEccEcEEccEEEcc---ccEcccc--------cHHcccccEE-EccEEEc-ccEEE|99   |128  
18  2cbp-      3|    1|-cEEccccccccccEEEc---ccEEHHHcc------ccEEc--EEEc---EEEccccEEE|96   |128  
19  1m56B     13|  191|------cccEEEcEEEEc---cEEc-------------EEEcccEEEc-cEEccccccEE|270  |128  
20  1hxmA     11|    2|-----cEEcEEEccEEEccccEEEEccEE----EcEEcEEEEcEEEcccccEEEEEEcEE|118  |128  
21  1jer-      2|    2|-cEEccccHHHcEcEEcc---ccEEHHHccc--cc-----cc-cEEcc--EEEccccEEE|106  |128  
22  1nif-     10|  215|-----cEEcEEEcEEEEc---ccEEcEEEc---cccEE-ccccEEEE-ccEEEcHHHEEE|323  |128  
23  1aozA     17|  203|--------cEEccEEEEcc-cEEEcc--EEEc-cEEEE-EEEcEEEEccccEEEEccEEE|299  |128  
24  1gff2     11|   53|-----cEEEEcccEEEEEcccEEEEEccc-------ccEEcEEEEEEcccEEEEE-----|149  |116  
25  1ten-     11|  803|-----ccEEEcc-cEEEccc-EEEEcc---------ccEEEE-cEEc-ccEEEEEEcEEE|891  |127  

[CLUSTALW_STYLE_LIKE_ALIGNMENT]

CLUSTAL W (1.74) multiple sequence alignment


QUERY           AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVV
1jzgA           AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVV
1qhqA           PAQTVEVRAAPALAFAQTSLSLPANT-VVRLDFVNQNNLG---VQHNWVLVNGDVAAAVN
1e30A           -TVHVVAAAVPFpSFEVPTLEIPAGA-TVDVTFINTNKG----FGHSFDITKK-GPp--Y
1fwxA           -KVRVYMSSV-ApSFSIESFTVKEGD-EVTVIVTNLDEID--DLTHGFTMGN--------
1kv7A           DRNRIQLTIGAGWGYNGPAVKLQRGK-AVTVDIYNQL-----TEETTLHWHGLEV-----
1cyx-           -PITIEVVSM-DWKWFFNEIAFPANT-PVYFKVTSNS------VMHSFFIPR--------
2cuaA           -QYTVYVLAF-AfGYQpNpIEVPQGA-EIVFKITSPD------VIHGFHVEG--------
1fftB           -PITIEVVSM-DWKWFFNEIAFPANT-PVYFKVTSNS------VMNSFFIPR--------
1ehkB           -QYTVYVLAF-AfGYQpNpIEVPQGA-EIVFKITSPD------VIHGFHVEG--------
1bxaA           ADGAIVVDIA-KMKYETPELHV---KVGDTVTWINRE-----AMPHNVHFVA-GVL----
1ibyA           ----------FNVLNEpETLVVKKGD-AVKVVVENKS-----PISEGFSIDA--------
1ikoP           -IVLEPIYWnSSnSKFGLVLYPQIGD-KLDIICPKVDKTVGQYEYYKVYMVDKDQADR-C
1kcw-           ----------RMYSVNLPGLSMCAED-RVKWYLFGMGN---EVDVHAAFFHGQAL-----
1bqk-           --ADFEVHMLNKMVFEpASLKVAP---GDTVTFIPTD------KGHNVETIKGMIP----
1l4iA           -----------GVALGATRVIYPEGQKQVQLAVTNNDDKS--SYLIQSWIENAEGKKD--
1n0lA           -----------AVSLDRTRAVFDGSEKSmTLDISNDNKQLP--YLAQAWIENENQEKII-
1plc-           ----IDVLLGGSLAFVpSEFSISPGE-KIVFKNNAG-------FpHNIVFDE-DSIPS--
2cbp-           --AVYVVGWT--FNTESWPKGKRF-RAGDILLFNYNP------SMHNVVVVNQGGFST-C
1m56B           ------------LLATDTAMVVPVNK-TVVVQVTGAD------VIHSWTVPA--------
1hxmA           ----------IELVPEHQTVPVSIGV-PATLRCSMKG-EAIGNYYINWYRKTQGNTMTFI
1jer-           -STVHIVGWSVSSPNFYSWAAGKTFRVGDSLQFNFPA------NAHNVHEMTKQSFDACF
1nif-           ---------PTHIVFNLTALTAAVGE-RVLVVHSQAN------RDTRPHLIGGHGDYVWA
1aozA           ----------------PYIFHVSPKK-TYRIRIASTTA----LAALNFAIGNH-----QL
1gff2           ----------HSGLCHVVRIDETNPTNHHALSIAGSLSNVPADMIAFAIRFEVVVPTAV-
1ten-           ----------LDAPSQIEVKDVTD--TTALITWFKPL-AEI--DGIELTYGIKDV-----
                                                                            

QUERY           TDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSAL
1jzgA           TDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSAL
1qhqA           TAAQNNA-DALFVPPDTPNALAWTAMLNAGESGSVTFRT--PAP-GTYLYICTFPGHYLG
1e30A           A--V-------MPV--IDpIVAGTGFSPVPGYTNFTWH---PTA-GTYYYVCQIPGHAAG
1fwxA           -------------------YGVAME-IGPQMTSSVTFVAAN---PGVYWYYCQWFALHME
1kv7A           -----------------PGEVDGGGIIPPGGKRSVTLNVD--QPAATCWFHPHQGRQVAG
1cyx-           -------------------LGSQIY-AMAGMQTRLHLI---ANEPGTYDGICAEIPGHSG
2cuaA           -------------------TNINVE-VLPGEVSTVRYTFK--RP-GEYRIICNQYLGHQN
1fftB           -------------------LGSQIY-AMAGMQTRLHLIAN---EPGTYDGISASYSGFSG
1ehkB           -------------------TNINVEVLP-GEVSTVRYTFK--RP-GEYRIICNQYLGHQN
1bxaA           ----------------GEAA-LKGPMMKKEQAYSLTFTEA-----GTYDYHCTP--HPF-
1ibyA           -------------------FGVQE-VIKAGETKTISFTAD-KA--GAFTIWCQLHPKNIH
1ikoP           T-----------IKKEnT---PLLnCARPDQDVKFTIKFQEFQKnKDYYIISTSnGVCQA
1kcw-           ------------TNKNYRID--TI-NLFPATLFDAYMVA-QNP--GEWMLSCQNLNHLKG
1bqk-           ----------------DGAEAFKSKIN---ENYKVTFTAP-----GVYGVKCTP--HYMG
1l4iA           ----------------ARFVITpPLFMQGKKENTLRIIDATNMPESLFWVNVKAFAIV--
1n0lA           ---------------TGpVIATpPVQLEPGAKSmVRLSTTPDILPSLFYFNLREIALQ--
1plc-           ---------------GVDASKISMDLLN-AKGETFEV---ALSNKGEYSFYCSP--HQGG
2cbp-           N-T-------------PAGA-KVYTS----GRDQIKLPK------GQSYFICNFPGHCQS
1m56B           -------------------FGVKQDAV-PGRLAQLWFRAE---REGIFFGQCSELISHAY
1hxmA           ---------YREKDIYGPGFNFQGDIDIAKNLAVLKIL--APSERDEGSYYCACDKLIFG
1jer-           VNSD-----NDV------------ERT---SpVIERLDEL-----GMHYFVCTVGTHCSN
1nif-           TG-------KFRNPPDLDQE---TWLIPGGTAGAAFYT---FRQPGVYAYVNHNLIEAFG
1aozA           LVVEAD----GNYVQPFYTS--DI-DIYSGESYSVLITTD-QNPSENYWVSVGTRPNTPP
1gff2           ----------------PALYDVYPIETFISFKDAVTIDSHPRTVGNDVYAGIMLWS----
1ten-           ----------------PGDR-TTIDLTE--DENQYSIGN--LKPDTEYEVSLISRMSSNP

QUERY           MKGTLTLK
1jzgA           MKGTLTLK
1qhqA           MKGTLTVT
1e30A           QFGKIVVK
1fwxA           MRGRMLVE
1kv7A           LAGLVVIE
1cyx-           MKFKAIAT
2cuaA           MFGTIVVK
1fftB           MKFKAIAT
1ehkB           MFGTIVVK
1bxaA           MRGKVVVE
1ibyA           LPGTLNVV
1ikoP           MKILMKVG
1kcw-           LQAFFQVQ
1bqk-           MVGVVQVG
1l4iA           SRIKLLYR
1n0lA           TKIKLFYR
1plc-           MVGKVTVN
2cbp-           MKIAVNAL
1m56B           MPITVKVV
1hxmA           KGTRVTVE
1jer-           QKLSINVV
1nif-           AAGHFKVT
1aozA           GLTLLNYL
1gff2           --------
1ten-           AKETFTT-


[ALIGNMENTS]

>1 1jzgA [b.6.1] "AZURIN"
#Naa 128 start 1 end 128 SqID 100 % crms  0.8 Ssse  2585 Sdis 162932 Rdis  93.7 Z 57.54

     :   E1             E2       E3           H1      E4     H2   
SecA : TTEEEEEB TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHH
ExBuA:eeeeeebebebeeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebb
    1:AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVV:60
      ************************************************************
    1:AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVV:60
SecB :   EEEEEB TTS BS SEEEE TT SEEEEEEE  SSS HHHH B  EEEEGGGHHHHH
ExBuB:eeeeeebebeeeeebeeeebebeeebeebebebebebeeeeeebbbbbbbbbeeebeebb
     :   E1             E2       E3           H1      E4     H2   

     :                     E5        E6              E7           
SecA :HHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTTTTT
ExBuA:eebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeebeee
   61:TDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSAL:120
      ************************************************************
   61:TDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSAL:120
SecB :HHHHTT GGGTTS TT TT  EE   B TT EEEEEEEGGG  TT  EEEE  STTGGGT
ExBuB:eebeeeeeeeebbeeebeebebebebbbeeeeeebebebeebeeeeebbbbbbbeebbee
     :                     E5        E6              E7           

     : E8     
SecA :SEEEEEE 
ExBuA:bebebebe
  121:MKGTLTLK:128
      ********
  121:MKGTLTLK:128
SecB :SEEEEEE 
ExBuB:bebebebe
     : E8     

//

>2 1qhqA [b.6.1] "AURACYANIN"
#Naa 139 start 15 end 139 SqID  29 % crms  2.1 Ssse  1414 Sdis 116237 Rdis  61.1 Z 37.73

     :   E1      -       E2       E3           H1      E4   --  H2
SecA : TTEEEEEB T-TS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEET--TTHH
ExBuA:eeeeeebebeb-eeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbe--eeee
    1:AECSVDIQGND-QMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTA--ADMQ:57
          *          *                      **      *****         
   15:PAQTVEVRAAPDALAFAQTSLSLPANT-VVRLDFVNQNNLG---VQHNWVLVNGGDDVAA:70
SecB : SEEEEEEB SSSSSBS SEEEEETT -EEEEEEEE  SS ---  B  EEESSSHHHHH
ExBuB:eeeeeebebbeeeeebeeeebebebeb-bbebbbbbebeee---bebbbbbbeeeeeebe
     :  E1               E2      -E3           ---     E4    H1   

     :                -        E5        E6              E7       
SecA :HHHHHHHHH GGGTTS- TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STT
ExBuA:ebbeebeeeeeeeebb-eeebeebebebebbbeeeebebebebeebeeeeebbbbbbbee
   58:GVVTDGMASGLDKDYL-KPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPG:116
       * *       *      **     * *     **  ****          *   *****
   71:AVNTAAQNNA-DALFVPPPDTPNALAWTAMLNAGESGSVTFRT--PAP-GTYLYICTFPG:126
SecB :HHHHHHHT G-GGTT   TT TTEEEE   B TTEEEEEEEE -- SS-EEEEEE  STT
ExBuB:ebbeebeebe-ebebbbeeebeebbbbbbbbeeeeeeebebeb--bee-eebbbbbbbee
     :          -            E5         E6       --   -E7         

     :   -  E8     
SecA :TTT-TSEEEEEE 
ExBuA:bee-ebebebebe
  117:HSA-LMKGTLTLK:128
      *    ******  
  127:HYLAGMKGTLTVT:139
SecB :TTTTT EEEEEEE
ExBuB:bbeeebebebebe
     :      E8     

//

>3 1e30A [b.6.1] "RUSTICYANIN"
#Naa 153 start 37 end 155 SqID  15 % crms  2.7 Ssse  1114 Sdis  74144 Rdis  35.2 Z 22.08

     :  E1     ----       ----- E2       E3           H1      E4  
SecA :TTEEEEEB ----TTS BS -----SEEEE TT SEEEEEEE  SS  HHHH B  EEEE
ExBuA:eeeeebebe----beeebee-----eebebeeebeebbbebebeeeeeeeebbbbbbbbb
    2:ECSVDIQGN----DQMQFNT-----NAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLST:52
         *             *                    *             **      
   37:TVHVVAAAVLPGFPFpSFEVHDKKNPTLEIPAGA-TVDVTFINTNKG----FGHSFDITK:91
SecB :EEEEEEEES TTS SS EEETTEES EEEE TT -EEEEEEEE  TT----     EEES
ExBuB:ebebbbbbbbeeeeebbbbbeeeeebebebeeeb-ebebbbbbbbee----ebbbbbbbe
     :E4               E5   E6  E7      -E8          ----     E9  

     :   H2                        E5       ----- E6              
SecA :TTTHHHHHHHHHHH GGGTTS TT TT SEE   B TT----- EEEEEEEGGGS TT  
ExBuA:eeeeeebbeebeeeeeeeebbeeebeebebebebbbee-----eebebebebeebeeeee
   53:AADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSG-----EKDSVTFDVSKLKEGEQ:107
                                   * *                *           
   92:K-GPp--YA--V-------MPV--IDpIVAGTGFSPVPKDGKFGYTNFTWH---PTA-GT:133
SecB : - SS--  --S-------S  --  SEEEEB      BTTEEEEEEEEE ---  S-EE
ExBuB:e-eee--be--e-------ebe--beebebbbbebeebeeeebbbbebebe---bee-ee
     : -   --  -- -------   --   E10           E11       ---   -E1

     :E7          -  E8     
SecA :EEEE  STTTTT-TSEEEEEE 
ExBuA:bbbbbbbeebee-ebebebebe
  108:YMFFCTFPGHSA-LMKGTLTLK:128
      *   *  *** *    *    *
  134:YYYVCQIPGHAATGQFGKIVVK:155
SecB :EEEE  STTTTTTT EEEEEE 
ExBuB:bbbbbbbeebbeeebebebebe
     :2              E13    

//

>4 1fwxA [b.69.3] "NITROUS OXIDE REDUCTASE"
#Naa 591 start 486 end 579 SqID  18 % crms  2.0 Ssse   994 Sdis  61265 Rdis   3.7 Z 18.85

     :  E1             E2       E3           H1      E4     H2    
SecA :TTEEEEEB TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHH
ExBuA:eeeeebebebeeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbe
    2:ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVT:61
         *         *     **       **              *               
  486:KVRVYMSSV-ApSFSIESFTVKEGD-EVTVIVTNLDEID--DLTHGFTMGN---------:532
SecB :EEEEEEEEE-TTEES SEEEEETT -EEEEEEEE   ST--T  EEEEETT---------
ExBuB:ebbbbbbbe-beebbbeebebeeeb-ebbbbbbbebeee--ebbbbbbbee---------
     :E33      -  E34  E35     -E36          --   E37    ---------

     :                    E5        E6              E7      --    
SecA :HHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  ST--TTTT
ExBuA:ebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbe--ebee
   62:DGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP--GHSA:119
                               **     ****          *   *         
     :------------------YGVAME-IGPQMTSSVTFVAAN---PGVYWYYCQWFCHALHM:570
SecB :------------------TTEEEE-E TT EEEEEEE  S--- EEEEEE  S  STT T
ExBuB:------------------bebbbb-bbbbbbbbbebebee---eeebebebeeebeeebe
     :------------------  E38 -     E39       --- E40             

     :  E8     
SecA :TSEEEEEE 
ExBuA:ebebebebe
  120:LMKGTLTLK:128
       * *     
  571:EMRGRMLVE:579
SecB :T EEEEEEE
ExBuB:ebebebebe
     :  E41    

//

>5 1kv7A [b.6.1] "PROBABLE BLUE-COPPER PROTEIN YACK"
#Naa 463 start 43 end 163 SqID  14 % crms  3.4 Ssse   811 Sdis  57674 Rdis   4.8 Z 15.73

     : -  E1       -----------    ----  E2       E3           H1  
SecA : -TTEEEEEB TT-----------S BS---- SEEEE TT SEEEEEEE  SS  HHHH
ExBuA:e-eeeeebebebe-----------eebe----eeebebeeebeebbbebebeeeeeeeeb
    1:A-ECSVDIQGNDQ-----------MQFN----TNAITVDKSCKQFTVNLSHPGNLPKNVM:44
                                 *      *          **             
   43:DARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGK-AVTVDIYNQL-----TE:96
SecB : TTSEEEEEEEEEEEEETTEEEEEEEESSSSB  EEEEETT -EEEEEEEE S-----SS
ExBuB:eeeeebebebbebebebeeeebebbbbeeeebbbbbebeeee-ebbbbbebeb-----ee
     :    E2             E3             E4      -E5        -----  

     :    E4     H2                        E5 --       E6         
SecA : B  EEEETTTHHHHHHHHHHH GGGTTS TT TT SEE --  B TT EEEEEEEGGGS
ExBuA:bbbbbbbbeeeeeebbeebeeeeeeeebbeeebeebebeb--ebbbeeeebebebebeeb
   45:GHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHT--KLIGSGEKDSVTFDVSKL:102
                                                  *  * * ***  *   
   97:ETTLHWHGLEV----------------------PGEVDGGPQGIIPPGGKRSVTLNVD--:132
SecB : B  EEET   ---------------------- GGGS  TT  B TT EEEEEEE  --
ExBuB:ebbbbbbbbbb----------------------ebebbbbbeeebeeeeeeebebebe--
     :    E6     ----------------------                E7       --

     :     E7     ----     -  E8     
SecA : TT  EEEE  S----TTTTT-TSEEEEEE 
ExBuA:eeeeebbbbbbb----eebee-ebebebebe
  103:KEGEQYMFFCTF----PGHSA-LMKGTLTLK:128
             *            *    *     
  133:QPAATCWFHPHQHGKTGRQVAMGLAGLVVIE:163
SecB :S SEEEEEE   TTTHHHHHHTT  EEEEEE
ExBuB:bebbbbbbbbbbeeebbebbbbbbbbbbbbb
     :   E8          H1        E9    

//

>6 1cyx- [b.6.1] "CYOA"
#Naa 158 start 126 end 225 SqID  10 % crms  2.3 Ssse   911 Sdis  51366 Rdis  23.7 Z 15.02

     :  E1            ---------- E2       E3           H1      E4 
SecA :TTEEEEEB TTS BS ----------SEEEE TT SEEEEEEE  SS  HHHH B  EEE
ExBuA:eeeeebebebeeebee----------eebebeeebeebbbebebeeeeeeeebbbbbbbb
    2:ECSVDIQGNDQMQFNT----------NAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLS:51
                                * *                         *     
  126:PITIEVVSM-DWKWFFIYPEQGIATVNEIAFPANT-PVYFKVTSNS------VMHSFFIP:177
SecB : EEEEEEEE-TTEEEEEETTTTEEEESEEEEETTS- EEEEEEESS------S EEEEEG
ExBuB:ebebbbbbb-bbbbbbbbeeeebbbbbbbbbbbeb-ebebebbbbe------eebbbebe
     : E1      -  E2        E3   E4      - E5       ------  E6    

     :    H2                        E5        E6              E7  
SecA :ETTTHHHHHHHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE
ExBuA:beeeeeebbeebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbb
   52:TAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFF:111
                                            *             *   *   
  178:R---------------------------LGSQIY-AMAGMQTRLHLI---ANEPGTYDGI:206
SecB :G---------------------------GTEEEE-E TT  EEEEE --- SSSEEEEEE
ExBuB:e---------------------------bebeee-beebeebebebe---beeeeebebe
     : ---------------------------  E7  -      E8    ---    E9    

     :    --      E8     
SecA :  ST--TTTTTSEEEEEE 
ExBuA:bbbe--ebeeebebebebe
  112:CTFP--GHSALMKGTLTLK:128
      *          **      
  207:CAEICGPGHSGMKFKAIAT:225
SecB :E S  STTSTT  EEEEEE
ExBuB:beeebeebeebbebebebb
     :             E10   

//

>7 2cuaA [b.6.1] "CUA"
#Naa 122 start 78 end 167 SqID  17 % crms  2.3 Ssse   873 Sdis  49362 Rdis  29.9 Z 14.06

     :  E1             E2       E3           H1      E4     H2    
SecA :TTEEEEEB TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHH
ExBuA:eeeeebebebeeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbe
    2:ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVT:61
         *            * * *             *         *               
   78:QYTVYVLAF-AfGYQpNpIEVPQGA-EIVFKITSPD------VIHGFHVEG---------:120
SecB :EEEEEEEEE-TTEEESSSEEEETTS-EEEEEEEBSS------S EEEEETT---------
ExBuB:eebbbbbbe-eebbbbeebebeeeb-ebbbbbbbbe------eebbbebee---------
     :E2       -  E3    E4     -E5        ------  E6     ---------

     :                    E5        E6              E7      --    
SecA :HHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  ST--TTTT
ExBuA:ebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbe--ebee
   62:DGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP--GHSA:119
                                  **   *            *   *         
     :------------------TNINVE-VLPGEVSTVRYTFK--RP-GEYRIICNQYCGLGHQ:158
SecB :------------------SS EEE-E BTB EEEEEE  --S -EEEEEE  S  STTST
ExBuB:------------------bebebe-beebebbebeeebe--ee-eebebbbeeebeeeee
     :------------------   E7 -      E8      --  -E9              

     :  E8     
SecA :TSEEEEEE 
ExBuA:ebebebebe
  120:LMKGTLTLK:128
       * **   *
  159:NMFGTIVVK:167
SecB :T EEEEEEE
ExBuB:ebebebebe
     :  E10    

//

>8 1fftB [f.2.1] "UBIQUINOL OXIDASE"
#Naa 257 start 126 end 225 SqID   8 % crms  2.4 Ssse   526 Sdis  48948 Rdis  13.3 Z 13.87

     :  E1            ---------- E2       E3           H1      E4 
SecA :TTEEEEEB TTS BS ----------SEEEE TT SEEEEEEE  SS  HHHH B  EEE
ExBuA:eeeeebebebeeebee----------eebebeeebeebbbebebeeeeeeeebbbbbbbb
    2:ECSVDIQGNDQMQFNT----------NAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLS:51
                                * *                               
  126:PITIEVVSM-DWKWFFIYPEQGIATVNEIAFPANT-PVYFKVTSNS------VMNSFFIP:177
SecB :  EEEEE  -TTS EEE TTT  EEESB    SSS-EEEEEE BSS------S EEEEEG
ExBuB:bbebbbbbb-eebbbbbbeeeebbbbbbbbbbbeb-ebbbebbbbe------eebbbbbe
     :  E1     -    E2       E3          -E4        ------  E5    

     :    H2                        E5        E6              E7  
SecA :ETTTHHHHHHHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE
ExBuA:beeeeeebbeebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbb
   52:TAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFF:111
                                            *             *   *   
  178:R---------------------------LGSQIY-AMAGMQTRLHLIAN---EPGTYDGI:206
SecB :G---------------------------GTEEEE-E BTS EEEEEE  ---S B  EEB
ExBuB:e---------------------------bebeee-beebeebebebebe---eeeebebe
     : ---------------------------  E6  -      E7      ---     E8 

     :     --     E8     
SecA :  STT--TTTTSEEEEEE 
ExBuA:bbbee--beeebebebebe
  112:CTFPG--HSALMKGTLTLK:128
                 **      
  207:SASYSGPGFSGMKFKAIAT:225
SecB :  S  STTTTT  EE  B 
ExBuB:bbeeeeebeebbebebebe
     :             E9    

//

>9 1ehkB [f.2.1] "BA3-TYPE CYTOCHROME-C OXIDASE"
#Naa 166 start 78 end 167 SqID  17 % crms  2.4 Ssse   875 Sdis  47549 Rdis  22.4 Z 13.20

     :  E1             E2       E3           H1      E4     H2    
SecA :TTEEEEEB TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHH
ExBuA:eeeeebebebeeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbe
    2:ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVT:61
         *            * * *             *         *               
   78:QYTVYVLAF-AfGYQpNpIEVPQGA-EIVFKITSPD------VIHGFHVEG---------:120
SecB :EEEEEEEEE-TTEEESSSEEEETTS-EEEEEEE SS------S EEEEETT---------
ExBuB:eebbebbbe-eebbebeebebeeeb-ebbbbbbbbe------eebbbebee---------
     :E2       -  E3    E4     -E5        ------  E6     ---------

     :                    E5        E6              E7      --    
SecA :HHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  ST--TTTT
ExBuA:ebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbe--ebee
   62:DGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP--GHSA:119
                                  **   *            *   *         
     :------------------TNINVEVLP-GEVSTVRYTFK--RP-GEYRIICNQYCGLGHQ:158
SecB :------------------SS EEEE T-TB EEEEEE  --S -EEEEEE  S  STTST
ExBuB:------------------bebebebee-bbbbbbeeebe--ee-eebebebeeebbebee
     :------------------   E7    -   E8      --  -E9              

     :  E8     
SecA :TSEEEEEE 
ExBuA:ebebebebe
  120:LMKGTLTLK:128
       * **   *
  159:NMFGTIVVK:167
SecB :T EEEEEEE
ExBuB:ebebebbbe
     :  E10    

//

>10 1bxaA [b.6.1] "AMICYANIN"
#Naa 105 start 17 end 105 SqID  20 % crms  3.7 Ssse  1081 Sdis  43728 Rdis  30.1 Z 11.16

     :   E1             E2       E3           H1      E4     H2   
SecA : TTEEEEEB TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHH
ExBuA:eeeeeebebebeeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebb
    1:AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVV:60
      *           *   *    *       **            * **             
   17:ADGAIVVDIA-KMKYETPELHV---KVGDTVTWINRE-----AMPHNVHFVA-GVL----:62
SecB : TT EEEEEE-TTEESSSEEEE--- TT EEEEEE S-----SS B  EE T-TTS----
ExBuB:eeeeeebebb-eeebeeeebeb---eeebebbbbbee-----eeebbbbbee-eeb----
     :    E3    -  E4   E5  ---    E6      -----      E7  -   ----

     :                     E5        E6              E7           
SecA :HHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTTTTT
ExBuA:eebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeebeee
   61:TDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSAL:120
                                       * **          *   **   *   
     :----------------GEAA-LKGPMMKKEQAYSLTFTEA-----GTYDYHCTP--HPF-:97
SecB :----------------SSS -EE   B TTEEEEEEE S -----EEEEEE SS-- TT-
ExBuB:----------------beee-bebeebeeeebbbbbbeee-----eebebbbee--eee-
     :----------------    -E8       E9        -----E10      --   -

     : E8     
SecA :SEEEEEE 
ExBuA:bebebebe
  121:MKGTLTLK:128
      * *     
   98:MRGKVVVE:105
SecB : EEEEEE 
ExBuB:bebebbbe
     : E11    

//

>11 1ibyA [b.6.1] "NITROSOCYANIN"
#Naa 112 start 31 end 111 SqID  14 % crms  2.6 Ssse   791 Sdis  38921 Rdis  25.2 Z 10.55

     :        E2       E3           H1      E4     H2             
SecA :TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGG
ExBuA:beeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeee
   11:DQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDK:70
                 * *      *                                       
   31:FNVLNEpETLVVKKGD-AVKVVVENKS-----PISEGFSIDA------------------:66
SecB :EEEEEES EEEEETT -EEEEEEEE S-----SS EEEEEGG------------------
ExBuB:eebebeeeebebeeee-ebebbbebeb-----eeebbbbbee------------------
     :        E3      -E4        -----   E5     ------------------

     :           E5        E6              E7            E8     
SecA :TTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTTTTTSEEEEEE 
ExBuA:ebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeebeeebebebebe
   71:DYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK:128
                      *  **     *              *          ***   
     :---------FGVQE-VIKAGETKTISFTAD-KA--GAFTIWCQLHPKNIHLPGTLNVV:111
SecB :---------GTEEE-EE TT EEEEEEE  -S --EEEEEB SSS TTTB  EEEEEE
ExBuB:---------bebee-ebeeeeeeebebebe-ee--eebebebeeeeeeebeebebebe
     :---------  E6 -      E7       -  --E8               E9    

//

>12 1ikoP [b.6.1] "EPHRIN-B2"
#Naa 141 start 31 end 168 SqID   8 % crms  4.2 Ssse   935 Sdis  53117 Rdis  27.8 Z 10.20

     :  E1           ----  E2       E3        -   H1      E4     H
SecA :TTEEEEEB TTS BS---- SEEEE TT SEEEEEEE  S-S  HHHH B  EEEETTTH
ExBuA:eeeeebebebeeebe----eeebebeeebeebbbebebee-eeeeeebbbbbbbbbeeee
    2:ECSVDIQGNDQMQFN----TNAITVDKSCKQFTVNLSHPG-NLPKNVMGHNWVLSTAADM:56
           *                                                      
   31:IVLEPIYWnSSnSKFLPGQGLVLYPQIGD-KLDIICPKVDSKTVGQYEYYKVYMVDKDQA:89
SecB : B   EE STT TTSBTTTBEEE   TT -EEEEE     SSS S   BEEEEEE HHHH
ExBuB:eeeeebebeeeeeebeeeebbeeebeeeb-ebbbbbbebeeeeeeeebbbbbbebeeebb
     :     E1             E2       -E3                 E4     H1  

     :2                        E5        E6       ---------       
SecA :HHHHHHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGG---------GS TT  
ExBuA:eebbeebeeeeeeeebbeeebeebebebebbbeeeebebebebe---------ebeeeee
   57:QGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS---------KLKEGEQ:107
          *            *                     *                    
   90:DR-CT-----------IKKEnT---PLLnCARPDQDVKFTIKFQEFSPnLWGLEFQKnKD:134
SecB :HH-TB-----------  TT  --- SEEE  TTS  EEEEE  SS SSTT     TTEE
ExBuB:ee-bb-----------beeeee---ebbebeebeeeeeeebebeeebeeeeeeebeeeee
     :  -  -----------      ---  E5        E6                   E7

     :E7       -----------   --  E8     
SecA :EEEE  STT-----------TTT--TSEEEEEE 
ExBuA:bbbbbbbee-----------bee--ebebebebe
  108:YMFFCTFPG-----------HSA--LMKGTLTLK:128
      *    *  *                 **      
  135:YYIISTSnGSLEGLDnQEGGVCQTRAMKILMKVG:168
SecB :EEEE    BSGGGTT  BSHHHHHS  EEEEEET
ExBuB:bbbbbbbebeeebbeeeebbbbeeebbebebebb
     :                   H2      E8     

//

>13 1kcw- [b.6.1] "CERULOPLASMIN"
#Naa 1017 start 239 end 336 SqID  11 % crms  4.8 Ssse   812 Sdis  42116 Rdis   0.9 Z 9.94

     :      ------  E2       E3           H1      E4     H2       
SecA :TTS BS------ SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHH
ExBuA:beeebe------eeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebe
   11:DQMQFN------TNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGM:64
           *                      *   **    *  *       *          
  239:RMYSVNGYTFGSLPGLSMCAED-RVKWYLFGMGN---EVDVHAAFFHGQAL---------:285
SecB :EEEESSS  SS     EEETTE-EEEEEEE   S---TT  EEEEETTS  ---------
ExBuB:ebbbbbbbbbbbbeebebbbeb-ebbbbbbbbbe---eebbbbbbbbbbbb---------
     :E14             E15  E-16         ---    E17       ---------

     :                 E5        E6              E7          -  E8
SecA :HH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTTTT-TSEE
ExBuA:eeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeebee-ebeb
   65:ASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSA-LMKG:123
                                                  *  *    *       
     :--------TNKNYRID--TI-NLFPATLFDAYMVA-QNP--GEWMLSCQNLNHLKAGLQA:331
SecB :--------  SSS  S--EE-EE TT EEEEEEEE- S --EEEEEEE  HHHHHT  EE
ExBuB:--------beeebbbb--bb-bbbbbbbbbbebeb-bbe--ebbbbbbbbbebbbbbbbb
     :--------        --E1-8     E19     -   --E20      H4      E2

     :     
SecA :EEEE 
ExBuA:ebebe
  124:TLTLK:128
           
  332:FFQVQ:336
SecB :EEEEE
ExBuB:bbebe
     :1    

//

>14 1bqk- [b.6.1] "PSEUDOAZURIN"
#Naa 124 start 1 end 93 SqID  23 % crms  3.6 Ssse   820 Sdis  38793 Rdis  23.1 Z 9.24

     : E1       -----      E2       E3           H1      E4     H2
SecA :TEEEEEB TT-----S BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHH
ExBuA:eeeebebebe-----eebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeee
    3:CSVDIQGNDQ-----MQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQ:57
                     * *      *       **             ***          
    1:ADFEVHMLNKGKDGAMVFEpASLKVAP---GDTVTFIPTD------KGHNVETIKGMIP-:50
SecB : EEEEEEEEEETTEEEEEESSEEEE T---T EEEEE SS------SS   EE TT S -
ExBuB:eeeebebbeeeeeeebbbeeeebebee---ebbbbbbbee------eebbbebbeebeb-
     : E1          E2      E3    ---  E4      ------     E5      -

     :                        E5        E6              E7        
SecA :HHHHHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTT
ExBuA:ebbeebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeeb
   58:GVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGH:117
                         *       *     *   ***          *   **   *
     :-------------------DGAEAFKSKIN---ENYKVTFTAP-----GVYGVKCTP--H:81
SecB :-------------------TT    B  TT---  EEEE  S -----EEEEEE TT--T
ExBuB:-------------------eeeeebebeee---eeeebebebe-----bbbbbbbee--b
     :-------------------           ---  E6      -----E7       -- 

     : -   E8     
SecA :T-TTSEEEEEE 
ExBuA:e-eebebebebe
  118:S-ALMKGTLTLK:128
          * *     
   82:YGMGMVGVVQVG:93
SecB :GGGT EEEEEES
ExBuB:beebbbbbbbbb
     :     E8     

//

>15 1l4iA [b.1.11] "SFAE PROTEIN"
#Naa 189 start 1 end 116 SqID   6 % crms  3.7 Ssse   568 Sdis  41394 Rdis  15.0 Z 8.68

     :       E2       E3           H1      E4     H2              
SecA :TS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGGT
ExBuA:eeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeeee
   12:QMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKD:71
                     **                        *                  
    1:GVALGATRVIYPEGQKQVQLAVTNNDDKS--SYLIQSWIENAEGKKD-------------:45
SecB : EEES SEEEEETT SEEEEEEEE  TT --EEEEEEEEEETTS B -------------
ExBuB:eeebeeebbebeeeeeebebebbbeeeee--ebebebebbbeeeeeb-------------
     : E1    E2       E3           --E4              -------------

     :          E5   -     E6         --  ---   E7     -------    
SecA :TS TT TT SEE   -B TT EEEEEEEGGGS-- T---T  EEEE  S-------TTTT
ExBuA:bbeeebeebebebeb-bbeeeebebebebeeb--ee---eeebbbbbbb-------eebe
   72:YLKPDDSRVIAHTKL-IGSGEKDSVTFDVSKL--KE---GEQYMFFCTF-------PGHS:118
              **                                                  
     :-----ARFVITpPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAMDLQFAIV:108
SecB :-----SSEEEESSEEEEESSEEEEEEEEE  TT S SSS EEEEEEEEEEE       EE
ExBuB:-----eebebeeeebebebeeeeebebeeebeeebeeeebbbbbbbbebeeeeeeeeeee
     :-----  E5    E6     E7                  E8                E9

     :   E8     
SecA :TTSEEEEEE 
ExBuA:eebebebebe
  119:ALMKGTLTLK:128
            *   
     :--SRIKLLYR:116
SecB :--EEEEEEEE
ExBuB:--eebbbbbb
     :--        

//

>16 1n0lA [b.1.11] "CHAPERONE PROTEIN PAPD"
#Naa 215 start 1 end 116 SqID  11 % crms  3.9 Ssse   553 Sdis  42108 Rdis  12.9 Z 8.55

     :       E2       E3           H1      E4     H2              
SecA :TS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGGT
ExBuA:eeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeeee
   12:QMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKD:71
                 * * *  *   *                                     
    1:AVSLDRTRAVFDGSEKSmTLDISNDNKQLP--YLAQAWIENENQEKII------------:46
SecB : EEES SEEEEETTSSEEEEEEEE  SS  --EEEEEEEE TTS EES------------
ExBuB:ebebeeebbebeeeeeeeebebbbeeeeee--bebebbbbbeeeeeee------------
     : E1    E2       E3            --E4           E5 ------------

     :          E5   -     E6          --  ----  E7      ---------
SecA :TS TT TT SEE   -B TT EEEEEEEGGGS --TT----  EEEE  ST---------
ExBuA:bbeeebeebebebeb-bbeeeebebebebeebe--ee----eebbbbbbbe---------
   72:YLKPDDSRVIAHTKL-IGSGEKDSVTFDVSKLK--EG----EQYMFFCTFP---------:115
                         * *  *                    *              
     :----TGpVIATpPVQRLEPGAKSmVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANV:102
SecB :----SSSEEEE SEEEE TT EEEEEEEE GGGGGS SSS EEEEEEEEEE    SSSS 
ExBuB:----ebebebeeeebebeeeeeeebebbeeeebeeeeeeebbbbbbbbebebeeeeeeee
     :----   E6    E7      E8                  E9                 

     :---      E8     
SecA :---TTTTTSEEEEEE 
ExBuA:---ebeeebebebebe
     :---GHSALMKGTLTLK:128
               *  *   
  103:LQIALQ--TKIKLFYR:116
SecB :     E--EEEEEEEE
ExBuB:eeeeee--eebbbbbb
     :     E--10      

//

>17 1plc- [b.6.1] "PLASTOCYANIN (CU2+, PH 6.0)"
#Naa  99 start 1 end 99 SqID  15 % crms  4.2 Ssse   796 Sdis  38848 Rdis  28.0 Z 8.16

     :1     ---        E2       E3           H1      E4     H2    
SecA :EEEEB ---TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHH
ExBuA:eebebe---beeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbe
    5:VDIQGN---DQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVT:61
       *           *                              ** *            
    1:IDVLLGADDGSLAFVpSEFSISPGE-KIVFKNNAG-------FpHNIVFDE-DSIPS---:48
SecB : EEEES TT  S EESSEEEE TT -EEEEEE SS-------  B  EE T-TSS T---
ExBuB:eebebbbeeeeeebeeeebebeeee-ebbbebbbe-------eebbbbbee-eebbe---
     : E1          E2  E3      -E4       -------     E5  -     ---

     :                    E5 ---       E6              E7         
SecA :HHHHH GGGTTS TT TT SEE ---  B TT EEEEEEEGGGS TT  EEEE  STTTT
ExBuA:ebeeeeeeeebbeeebeebebeb---ebbbeeeebebebebeebeeeeebbbbbbbeebe
   62:DGMASGLDKDYLKPDDSRVIAHT---KLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHS:118
                                 *               *     * * *    * 
     :--------------GVDASKISMSEEDLLN-AKGETFEV---ALSNKGEYSFYCSP--HQ:88
SecB :--------------T  HHHH   TT  B -STT EEEE---E  S EEEEEE GG--GT
ExBuB:--------------ebebeebbbeeeeebe-eeeeeeeb---ebeeeeebebbbee--be
     :--------------   H1           -    E6  ---     E7       --  

     : -  E8     
SecA :T-TSEEEEEE 
ExBuA:e-ebebebebe
  119:A-LMKGTLTLK:128
         * *  *  
   89:GAGMVGKVTVN:99
SecB :TTT EEEEEE 
ExBuB:eeebebebebe
     :    E8     

//

>18 2cbp- [b.6.1] "CUCUMBER BASIC PROTEIN"
#Naa  96 start 1 end 96 SqID  14 % crms  3.9 Ssse   734 Sdis  37563 Rdis  27.8 Z 7.77

     : E1  ----           E2       E3           H1      E4     H2 
SecA :TEEEE----EB TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHH
ExBuA:eeeeb----ebebeeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeee
    3:CSVDI----QGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQG:58
                                                     ** *         
    1:AVYVVGGSGGWT--FNTESWPKGKRF-RAGDILLFNYNP------SMHNVVVVNQGGFST:51
SecB : EEETTGGG S --TT TTTTTT  B- TT EEEEE  T------TT  EEEE HHHHHH
ExBuB:eeeebeeeebbe--eebeebbeeeeb-eeebebbbebee------eebbbbebeeebbee
     : E1         --            -    E2      ------    E3   H1    

     :                       E5        E6              E7         
SecA :HHHHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTTT
ExBuA:bbeebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeebe
   59:VVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHS:118
                                        *             *  * * **** 
     :-CN-T-------------PAGA-KVYTS----GRDQIKLPK------GQSYFICNFPGHC:85
SecB :-T - ------------- TT -EEE S----SEEEEE  S------EEEEEE  STTTG
ExBuB:-be-e-------------eeee-eeeee----bebebebee------eebbbbbeeeebb
     :-  - -------------    -E4   ---- E5      ------E6           

     :  - E8     
SecA :TT-SEEEEEE 
ExBuA:ee-bebebebe
  119:AL-MKGTLTLK:128
         **      
   86:QSGMKIAVNAL:96
SecB :GGT EEEEEE 
ExBuB:eebbbbebebe
     :    E7     

//

>19 1m56B [f.2.1] "CYTOCHROME C OXIDASE"
#Naa 260 start 191 end 270 SqID  14 % crms  3.9 Ssse   870 Sdis  31635 Rdis   8.3 Z 7.66

     :      E2       E3           H1      E4     H2               
SecA :S BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGGTT
ExBuA:eebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeeeeb
   13:MQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDY:72
            *  *        *              * *                        
  191:LLATDTAMVVPVNK-TVVVQVTGAD------VIHSWTVPA--------------------:223
SecB :TT BSS EEEETT -EEEEEEEESS------S EEEEEGG--------------------
ExBuB:ebbbebbbbbbbee-bbbbebbbee------eebbbbbeb--------------------
     :       E4     -E5        ------  E6     --------------------

     :         E5        E6              E7      --      E8     
SecA :S TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  ST--TTTTTSEEEEEE 
ExBuA:beeebeebebebebbbeeeebebebebeebeeeeebbbbbbbe--ebeeebebebebe
   73:LKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP--GHSALMKGTLTLK:128
                       *      *              *        * *  *    
     :-------FGVKQDAV-PGRLAQLWFRAE---REGIFFGQCSELCGISHAYMPITVKVV:270
SecB :-------GTEEEEE -TT  EEEEEE S---S EEEEE   S  SSGGGS  EEEEEE
ExBuB:-------bebeeebe-eeeeeebbbebe---eebbbbbebeeebeebeeebbbbbbbb
     :-------  E7    -    E8      ---  E9                 E10   

//

>20 1hxmA [b.1.1] "GAMMA-DELTA T-CELL RECEPTOR"
#Naa 206 start 2 end 118 SqID  10 % crms  4.2 Ssse   524 Sdis  43497 Rdis  14.9 Z 7.21

     :        E2       E3           H1      E4     H2             
SecA :TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGG
ExBuA:beeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeee
   11:DQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDK:70
                 *       *   *  *         **   *                  
    2:IELVPEHQTVPVSIGV-PATLRCSMKG-EAIGNYYINWYRKTQGNTMTFI---------Y:50
SecB :  EEES SEEEEETT - EEEEEEE S-S GGGSEEEEEEEESSS SEEE---------E
ExBuB:eebebeeeebebebee-ebebebebee-eebeebebbbebebeeeeeeeb---------b
     :  E1    E2      - E3       -      E4           E5 --------- 

     :          -- E5        E6              E7      ----------   
SecA :TTS TT TT --SEE   B TT EEEEEEEGGGS TT  EEEE  ST----------TTT
ExBuA:ebbeeebeeb--ebebebbbeeeebebebebeebeeeeebbbbbbbe----------ebe
   71:DYLKPDDSRV--IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP----------GHS:118
                                         *       *                
   51:REKDIYGPGFKDNFQGDIDIAKNLAVLKIL--APSERDEGSYYCACDTLGMGGEYTDKLI:108
SecB :ETTTEE TTTTTTEEEEEEGGGTEEEEEES--S  GGG EEEEEEEE    SSS     E
ExBuB:ebeeebbeebeeebebebeeeeeebbbebe--ebbeebebebbbbbbeeeeeeeeeeeee
     :    E6       E7        E8     --       E9                  E

     :   E8     
SecA :TTSEEEEEE 
ExBuA:eebebebebe
  119:ALMKGTLTLK:128
             *  
  109:FGKGTRVTVE:118
SecB :EB  EEEEEE
ExBuB:ebeebebebe
     :10  E11   

//

>21 1jer- [b.6.1] "CUCUMBER STELLACYANIN"
#Naa 110 start 2 end 106 SqID  11 % crms  4.1 Ssse   845 Sdis  38397 Rdis  25.7 Z 7.02

     :  E1  ----    -       -E2       E3           H1      E4 -   
SecA :TTEEEE----EB T-TS BS S-EEEE TT SEEEEEEE  SS  HHHH B  EEE-ETT
ExBuA:eeeeeb----ebeb-eeebeee-ebebeeebeebbbebebeeeeeeeebbbbbbbb-bee
    2:ECSVDI----QGND-QMQFNTN-AITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLS-TAA:54
                                              *         **     *  
    2:STVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPA------NAHNVHEMETKQ:55
SecB :  EEETTGGG SS  SSTTHHHHHHHT  EETT EEEE   T------TT   EEES HH
ExBuB:eeebebbeeebbeebeeeeebeebbeeeebeebbbbebebee------eebbbeebeeee
     :  E1               H1        E2   E3      ------     E4   H2

     : H2  -                      E5        E6              E7    
SecA :THHHH-HHHHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  
ExBuA:eeeeb-beebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbb
   55:DMQGV-VTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCT:113
                       *                          *           * **
   56:SFDACNFVNSD-----NDV------------ERT---SpVIERLDEL-----GMHYFVCT:90
SecB :HHHHT  TTS -----   ------------   ---S EEEE  SS-----EEEEEE  
ExBuB:bbeebeeeeee-----eee------------eee---eebeeebeee-----eebbbbbb
     :           -----   ------------   ---  E5      -----E6      

     :       - E8     
SecA :STTTTTT-SEEEEEE 
ExBuA:beebeee-bebebebe
  114:FPGHSAL-MKGTLTLK:128
         *     *      
   91:VGTHCSNGQKLSINVV:106
SecB :STTTGGGT EEEEEEE
ExBuB:beeebeebbebebebe
     :         E7     

//

>22 1nif- [b.6.1] "NITRITE REDUCTASE"
#Naa 333 start 215 end 323 SqID  17 % crms  7.0 Ssse   900 Sdis  39270 Rdis   6.0 Z 6.71

     :       -----  ---E2       E3           H1      E4     H2    
SecA : TTS BS----- S---EEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHH
ExBuA:ebeeebe-----ee---ebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbe
   10:NDQMQFN-----TN---AITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVT:61
           **          * *         *  *               *          *
  215:PTHIVFNGAVGALTGDHALTAAVGE-RVLVVHSQAN------RDTRPHLIGGHGDYVWAT:267
SecB : SEEEETTBTTTTSGGG EEEETT -EEEEEEEESS------S B EEEET  EEEEETT
ExBuB:bbbbbbbbeeeebeeeebbebeeee-ebbbbbbbbe------eebebbbeebebbebbbe
     :  E13             E14    -E15       ------    E16    E17    

     :                    E5        E6              E7          --
SecA :HHHHH GGGTTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  STTTTT--
ExBuA:ebeeeeeeeebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbeebee--
   62:DGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSA--:119
              *    **       * **  *                 *             
  268:G-------KFRNPPDLDQE---TWLIPGGTAGAAFYT---FRQPGVYAYVNHNLIEAFEL:314
SecB : ------- TTS  EEEES---S  B TTEEEEEEEE---  S EEEEEEESSHHHHHTT
ExBuB:b-------ebeeebeeeee---ebebeeebbbbbbbe---bebbeebbbbbeeeebbeee
     : -------      E18  ---       E19     ---    E20      H3     

     :  E8     
SecA :TSEEEEEE 
ExBuA:ebebebebe
  120:LMKGTLTLK:128
         *     
  315:GAAGHFKVT:323
SecB :S EEEEEEE
ExBuB:bbbbebebe
     :  E21    

//

>23 1aozA [b.6.1] "ASCORBATE OXIDASE (E.C.1.10.3.3)"
#Naa 552 start 203 end 299 SqID  13 % crms  7.1 Ssse   841 Sdis  36051 Rdis   2.3 Z 6.37

     :  E2       E3           H1      E4     H2                   
SecA : SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGGTTS TT
ExBuA:eeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeeeebbeee
   17:TNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPD:76
           *                        *                 *           
  203:PYIFHVSPKK-TYRIRIASTTA----LAALNFAIGNH-----QLLVVEAD----GNYVQP:248
SecB :   EEE TT -EEEEEEEE  S----S EEEEEETT ----- EEEEEET----TEEEEE
ExBuB:eeebebeeee-ebbbbbbbbbb----bbbbbbbbbeb-----ebbbbbbb----bbebee
     :   E11    -E12        ----  E13      ----- E14    ---- E15  

     :     E5        E6              E7      ---      E8     
SecA : TT SEE   B TT EEEEEEEGGGS TT  EEEE  ST---TTTTTSEEEEEE 
ExBuA:beebebebebbbeeeebebebebeebeeeeebbbbbbbe---ebeeebebebebe
   77:DSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP---GHSALMKGTLTLK:128
                * ***  **          * *                   *   
  249:FYTS--DI-DIYSGESYSVLITTD-QNPSENYWVSVGTRARHPNTPPGLTLLNYL:299
SecB :EEES-- E-EE TT EEEEEEE  -S TT  EEEEEEEESS   S  EEEEEEET
ExBuB:bebe--bb-bbbbbbbbbbbbebe-eeeeebbbbbbbbbbbeeebeebbbbbbbe
     :    -- E-16    E17      -      E18             E19     

//

>24 1gff2 [b.10.1] "BACTERIOPHAGE G4 CAPSID PROTEINS GPF, GPG, GPJ"
#Naa 177 start 53 end 149 SqID  10 % crms  5.5 Ssse   472 Sdis  33593 Rdis  13.1 Z 6.32

     :        E2       E3           H1      E4   ---  H2          
SecA :TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEET---TTHHHHHHHHHHH 
ExBuA:beeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbe---eeeeebbeebeeee
   11:DQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTA---ADMQGVVTDGMASG:67
               *                       *                 *        
   53:HSGLCHVVRIDETNPTNHHALSIAGSLSNVPADMIAFAIRFEVADGVVPTAV--------:104
SecB :S EEEEEEE     S SEEEEEEEEEESS  TT EEEEEEEEEETT   SB --------
ExBuB:ebbbbbbbebeeeeeeeebebbbbbebeebeeebebbbbbbebeeeeebeeb--------
     :  E5             E6               E7                --------

     :              E5     -----   E6              E7       
SecA :GGGTTS TT TT SEE   B -----TT EEEEEEEGGGS TT  EEEE  STT
ExBuA:eeeebbeeebeebebebebbb-----eeeebebebebeebeeeeebbbbbbbee
   68:LDKDYLKPDDSRVIAHTKLIG-----SGEKDSVTFDVSKLKEGEQYMFFCTFPG:116
                                   ** ** *      *           
     :---------PALYDVYPIETFNNGKAISFKDAVTIDSHPRTVGNDVYAGIMLWS:149
SecB :--------- S  EEE   EEE SS EEE EEEEEE S SSTTEEEEEEEEEE 
ExBuB:---------eeeeeebebeeeeeeeebebebebebbbeeeeeebbbbbbbbbeb
     :---------    E8    E9     E10 E11          E12        

//

>25 1ten- [b.1.2] "TENASCIN (THIRD FIBRONECTIN TYPE III REPEAT)"
#Naa  89 start 803 end 891 SqID  13 % crms  4.1 Ssse   433 Sdis  31630 Rdis  24.4 Z 6.04

     :        E2       E3           H1      E4     H2             
SecA :TTS BS SEEEE TT SEEEEEEE  SS  HHHH B  EEEETTTHHHHHHHHHHH GGG
ExBuA:beeebeeeebebeeebeebbbebebeeeeeeeebbbbbbbbbeeeeeebbeebeeeeeee
   11:DQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDK:70
                 *             *        *                         
  803:LDAPSQIEVKDVTD--TTALITWFKPL-AEI--DGIELTYGIKDV---------------:842
SecB :    EEEEEES  S--S EEEEEE  S-S  --SEEEEEEEETT ---------------
ExBuB:eeebeebeeeeeee--eebbbbbeebe-eeb--ebbebbbbeeee---------------
     :    E1        --  E2       -   -- E3         ---------------

     :           E5        E6              E7      ---      E8    
SecA :TTS TT TT SEE   B TT EEEEEEEGGGS TT  EEEE  ST---TTTTTSEEEEEE
ExBuA:ebbeeebeebebebebbbeeeebebebebeebeeeeebbbbbbbe---ebeeebebebeb
   71:DYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFP---GHSALMKGTLTL:127
                     *               **    *            *   * * * 
     :------PGDR-TTIDLTE--DENQYSIGN--LKPDTEYEVSLISRRGDMSSNPAKETFTT:891
SecB :------TT  -EEEEEET--T  EEEE S--  TT EEEEEEEEEETTEE   EEEEEE 
ExBuB:------eeee-eeeebee--eeeeeebee--beeebebbbbbebeeeeeebeeeeeebeb
     :------    -E4     --   E5    --     E6          E7   E8     

//

Comments and Questions to :

Back to MATRAS HELP page

Back to MATRAS title page