### Sample Query Sequence Pairs for the service "HOMCOS:Model Hetero Dimer" ###

-------------------------------------------------------------
### for protein A  ###
>CDC28_YEAST [P00546] "Cell division control protein 28 (EC 2.7.11.22)"
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES

### for protein B  ###
>CG24_YEAST [P24871] "G2/mitotic-specific cyclin-4"
MMLEGYTVQPPQSTLIGDIEIQDENANQEVKNVLYQGVQKGIKRLEKRQRRVALGDVTSQ
KANKIHNAIHNKFHQTKNNFEIENIRSSALVKEQQRDVRHEDSDYFLIDSSEGSSTDDEQ
VNEDAIDDLLSRRVNDQQIQADEVYEDFDGEMQDVIEEDVDSQIEPLSPINNDEIQTELD
RAFEKYFRSVPNPLDDDTHDVVMVVEYASDIFYYLRELEVKYRPNPYYMQNQVELTWPFR
RTMIDWLVQLHFRFQLLPETLYLTINIVDRFLSKKTVTLNRFQLVGVSALFIAAKFEEIN
CPTLDDLVYMLENTYTRDDIIRAEQYMIDTLEFEIGWPGPMPFLRRISKADDYDFEPRTL
AKYLLETTIVEPKLVAAAPSWLAAGAYFLSRTILGSNDWSLKHVFYSGYTSSQIIPLASL
ILENCKNASRRHHSIWKKYFDQKHYRCSQIVEEWIVSTEA
-------------------------------------------------------------
### for protein A  ###
>SNO1_YEAST [Q03144] "Probable glutamine amidotransferase SNO1 (EC 2.6.-.-)"
MHKTHSTMSGKSMKVIGVLALQGAFLEHTNHLKRCLAENDYGIKIEIKTVKTPEDLAQCD
ALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLENESALVKTL
GVLKVDVRRNAFGRQAQSFTQKCDFSNFIPGCDNFPATFIRAPVIERILDPIAVKSLYEL
PVNGKDVVVAATQNHNILVTSFHPELADSDTRFHDWFIRQFVSN

### for protein B  ###
>SNZ1_YEAST [Q03148] "Pyridoxine biosynthesis protein SNZ1 (PDX1 homolog 1) (p35)"
MTGEDFKIKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRM
SDPKMIKDIMNSVSIPVMAKVRIGHFVEAQIIEALEVDYIDESEVLTPADWTHHIEKDKF
KVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRITEEIKACQQLKSED
DIAKVAEEMRVPVSLLKDVLEKGKLPVVNFAAGGVATPADAALLMQLGCDGVFVGSGIFK
SSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASNGVRLSEIGW

-------------------------------------------------------------
### for protein A  ###
>MDJ2_YEAST [P42834] "Mitochondrial DnaJ homolog 2"
MVLPIIIGLGVTMVALSVKSGLNAWTVYKTLSPLTIAKLNNIRIENPTAGYRDALKFKSS
LIDEELKNRLNQYQGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDR
GGSPYMAAKINEAKEVLERSVLLRKR

### for protein B  ###
>TIM16_YEAST [P42949 Q6B2X3] "Mitochondrial import inner membrane translocase subunit TIM16(Presequence translocated-associated motor subunit PAM16)"
MAHRAFIQVIITGTQVFGKAFAEAYRQAASQSVKQGATNASRRGTGKGEYGGITLDESCK
ILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAK
AKAGDASTAKPPPNSTNSSGADNSASSNQ


-------------------------------------------------------------
### for protein A  ###
>GDI1_YEAST [P39958] "Rab GDP-dissociation inhibitor (Rab GDI) (Secretory pathway GDPdissociation inhibitor)"
MDQETIDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKF
KQNPISKEERESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFK
QGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVY
YKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLG
ELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIADPTYFPEK
CKSTGQRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHY
LAIISTIIETDKPHIELEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYLSRSYDASSH
FESMTDDVKDIYFRVTGHPLVLKQRQEQEKQ

### for protein B  ###
>VPS21_YEAST [P36017] "Vacuolar protein sorting-associated protein 21 (GTP-binding proteinYPT51) (Vacuolar protein-targeting protein 12)"
MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEI
WDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGN
KIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQN
SASNERESNNQRVDLNAANDGTSANSACSC
-------------------------------------------------------------


-------------------------------------------------------------
### for protein A  ###
>RPB4_YEAST [P20433] "DNA-directed RNA polymerase II 32 kDa polypeptide (EC 2.7.7.6) (B32)"
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIK
EALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETRE
KELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQL
GSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

### for protein B  ###
>RPB7_YEAST [P34087] "DNA-directed RNA polymerase II 19 kDa polypeptide (EC 2.7.7.6) (B16)"
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGR
ILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLT
FNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
-------------------------------------------------------------