### Sample Query Sequences for the service "HOMCOS:Find interacting proteins" ###
>SNO1_YEAST [Q03144] "Probable glutamine amidotransferase SNO1 (EC 2.6.-.-)"
MHKTHSTMSGKSMKVIGVLALQGAFLEHTNHLKRCLAENDYGIKIEIKTVKTPEDLAQCD
ALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLENESALVKTL
GVLKVDVRRNAFGRQAQSFTQKCDFSNFIPGCDNFPATFIRAPVIERILDPIAVKSLYEL
PVNGKDVVVAATQNHNILVTSFHPELADSDTRFHDWFIRQFVSN

>UBIQ_YEAST [P61864 P04838 Q6LA96] "Ubiquitin"
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGG

>MDJ2_YEAST [P42834] "Mitochondrial DnaJ homolog 2"
MVLPIIIGLGVTMVALSVKSGLNAWTVYKTLSPLTIAKLNNIRIENPTAGYRDALKFKSS
LIDEELKNRLNQYQGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDR
GGSPYMAAKINEAKEVLERSVLLRKR

>CAPZA_YEAST [P28495] "F-actin capping protein subunit alpha"
MSSSKFEEVINKIINDSPPGELREVYDDLIKITSENSKNTILDAIENYNVQNCIPIEVNG
NSVIISKYNKEGAKFFDPVNSVIFSVNHLERKGLDIEPYEFTHAKIEKGQLKELHDKLHE
YLLQSFPGDVSFAVYPVPEEISKISIIIVSTKYNPNNFWNGHWRSSYIYDLETRELSGQI
STQVHYYEDGNVSFQSGKDINQSNVDDVVCTIRDIETNFENDLDLSFFDLNEKQFKALRR
RLPVTRSKINWGSAIGSYRLGKNAAEGK

>CDC28_YEAST [P00546] "Cell division control protein 28 (EC 2.7.11.22)"
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES

>CG24_YEAST [P24871] "G2/mitotic-specific cyclin-4"
MMLEGYTVQPPQSTLIGDIEIQDENANQEVKNVLYQGVQKGIKRLEKRQRRVALGDVTSQ
KANKIHNAIHNKFHQTKNNFEIENIRSSALVKEQQRDVRHEDSDYFLIDSSEGSSTDDEQ
VNEDAIDDLLSRRVNDQQIQADEVYEDFDGEMQDVIEEDVDSQIEPLSPINNDEIQTELD
RAFEKYFRSVPNPLDDDTHDVVMVVEYASDIFYYLRELEVKYRPNPYYMQNQVELTWPFR
RTMIDWLVQLHFRFQLLPETLYLTINIVDRFLSKKTVTLNRFQLVGVSALFIAAKFEEIN
CPTLDDLVYMLENTYTRDDIIRAEQYMIDTLEFEIGWPGPMPFLRRISKADDYDFEPRTL
AKYLLETTIVEPKLVAAAPSWLAAGAYFLSRTILGSNDWSLKHVFYSGYTSSQIIPLASL
ILENCKNASRRHHSIWKKYFDQKHYRCSQIVEEWIVSTEA

>VPS21_YEAST [P36017] "Vacuolar protein sorting-associated protein 21 (GTP-binding proteinYPT51) (Vacuolar protein-targeting protein 12)"
MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEI
WDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGN
KIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQN
SASNERESNNQRVDLNAANDGTSANSACSC

>GDI1_YEAST [P39958] "Rab GDP-dissociation inhibitor (Rab GDI) (Secretory pathway GDPdissociation inhibitor)"
MDQETIDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKF
KQNPISKEERESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFK
QGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVY
YKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLG
ELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIADPTYFPEK
CKSTGQRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHY
LAIISTIIETDKPHIELEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYLSRSYDASSH
FESMTDDVKDIYFRVTGHPLVLKQRQEQEKQ

>RPB4_YEAST [P20433] "DNA-directed RNA polymerase II 32 kDa polypeptide (EC 2.7.7.6) (B32)"
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIK
EALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETRE
KELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQL
GSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

>RPB7_YEAST [P34087] "DNA-directed RNA polymerase II 19 kDa polypeptide (EC 2.7.7.6) (B16)"
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGR
ILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLT
FNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI